PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g091830.1
Common NameMTR_8g091830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 838aa    MW: 93129.2 Da    PI: 4.6973
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g091830.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-10603646146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+W+t + e++++a++q+G++ ++ I + ++  +t+ q+k+++ k
  Medtr8g091830.1 603 RGKWSTRDTEKFYEAIRQFGTD-FTMIQQLFP-DKTRHQIKLKYKK 646
                      89********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159636.2E-27596681No hitNo description
Gene3DG3DSA:1.10.10.605.3E-6599646IPR009057Homeodomain-like
PROSITE profilePS512939.781601649IPR017884SANT domain
SMARTSM007172.7E-8602650IPR001005SANT/Myb domain
SuperFamilySSF466893.21E-10604652IPR009057Homeodomain-like
CDDcd001672.30E-6605646No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MDDLFDDIVP TTTTTTRARG RFAPKAKPKP PPPQKNNVSA STTHEESQLI SPKNDSHNAD  60
INVNNVTAQS VHPANAVENV LNNAAAVSTT DSTIGSNKEL PTNGEGSFLD SNKSLEVIDN  120
SLEVSLNAGF KSASGDINNG ISESDLHSSF EFGEVREVLS AEIELDPFSD VLPDPGTGKA  180
KKFQPKIKPR PRVSNTPATA SASSGIPFSE DDRSLEAVIP SHSDSLNAMP SESAVHDGTR  240
DFPSSFGKSV AENADIFSGL ESLDDILNQD ATGTAKPDLK SFNVNGAEEK FVLPGYDGKS  300
RSEIQEGADL NPDPDCPIDN VYDDYQSMKS GIDPTSEIPR HEGLTNSPDS PTLADLLQQD  360
DAGEKEVANE RKKSLKKHKI SSIAGVEDKG GKSSRKPRKQ AASKPTKNSL NEAVNGDDVL  420
DPPYVIDGDE LEENDDDDDV DYSSKKTSAS TSSKKKSVAK KGKTSKKRKK ANDDSEKVTE  480
EPPKKFPHAS RRRKRCVDKA LLENDYLDQR TIPIRDIILI AEHKERLAKK EATPSQTPST  540
NQSDGDFHHD VDFHHEADAN YEEEFFGSDD EFRDLDDDDR ATEKITSTTP LLNYQSFMDK  600
APRGKWSTRD TEKFYEAIRQ FGTDFTMIQQ LFPDKTRHQI KLKYKKEERQ HPLLLTDAMN  660
NRGKDLSFFK LVVEKQKQNS NKEEDTAEDA SDLMIGEGEE NEDPTPGTKE EVATAEQEQD  720
HINVKDQEDS MAYPVPEQSD DSDDGLQNNE DAWSVLGVLC DMKIPFKLKG KIYRTTVRPT  780
MVYEIESWAV KNQHKHKVSV VEMTMLRWMY GETKEDRIRN DDIRKSWGNN YSRKETS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1453469KKKSVAKKGKTSKKRKK
2465469KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1674040.0AC167404.11 Medicago truncatula clone mth2-9d11, complete sequence.
GenBankAC2024850.0AC202485.8 Medicago truncatula clone mth2-176b2, complete sequence.
GenBankAC2035410.0AC203541.4 Medicago truncatula clone mth2-20k1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630104.10.0myb-like DNA-binding domain protein
TrEMBLG7LBA00.0G7LBA0_MEDTR; Myb-like DNA-binding domain protein
STRINGGLYMA11G01285.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.15e-37MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]